dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H0Y9D2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H0Y9D2|H0Y9D2_HUMAN) O-phosphoseryl-tRNA(Sec) selenium transferase {ECO:0000313|Ensembl:ENSP00000423850} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SEPSECS OC=Catarrhini; Hominidae; Homo.
Sequence length 95
Sequence
XKYIIWPRIDQKSCFKSMITAGFEPVVIENVLEGDELRTDLKAVEAKVQELGPDCILCIH
STTSCFAPRVPDRKSFSFTFFRCPYYFIVTWIKWL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]