dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H0YIZ0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H0YIZ0|H0YIZ0_HUMAN) Serine hydroxymethyltransferase, mitochondrial {ECO:0000313|Ensembl:ENSP00000450490} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=SHMT2 OC=Catarrhini; Hominidae; Homo.
Sequence length 264
Sequence
XGLIDYNQLALTARLFRPRLIIAGTSAYARLIDYARMREVCDEVKAHLLADMAHISGLVA
AKVIPSPFKHADIVTTTTHKTLRGARSGLIFYRKGVKAVDPKTGREIPYTFEDRINFAVF
PSLQGGPHNHAIAAVAVALKQACTPMFREYSLQVLKNARAMADALLERGYSLVSGGTDNH
LVLVDLRPKGLDGARAERVLELVSITANKNTCPGDRSAITPGGLRLGAPALTSRQFREDD
FRRVVDFIDEGVNIGLEVKSKTGE

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]