dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H0Z526 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H0Z526|H0Z526_TAEGU) Doublesex and mab-3 related transcription factor 3 {ECO:0000313|Ensembl:ENSTGUP00000005672} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN=DMRT3 OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence length 467
Sequence
MNGYVSPYLYMGGPVSQPPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCKKCIL
IIERQRVMAAQVALRRQQANESLESLLPDSLRSLPGPPGNAEPPAPPPGPSTCAVPPRTP
AELAAATALRWDTEPTPALPGPHPKADVNEERLGDASGADSAETYSDKDTDQRSSPDMTK
TKSCFNPESPEIVSVDEVGFAVQKNGGGTENRPDSPKYHPEQNHLLIEGPSGTVSLPFSL
KANRPPLEVLKKIFPNQKPAVLELILKGCGGDLVSAVEVLLSSRSSVASGERSSAESDGL
VLPSNGHIFEHTLSSYPISSSKWSVGSAFRVPDTLRFSADSSNVVPNPLAVPLQHPFPQP
PRYPLMLRNTLARNQSSPFLPNDVTLWNTMTLQQQYQLRSQYVSPFSSSSATVFRSSPVL
PSRSSEDPRISIPDDGCPIVSKQPIYTEDEYEDRSDSSDSRILNTSS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]