dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H1A1K0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H1A1K0|H1A1K0_TAEGU) Uncharacterized protein {ECO:0000313|Ensembl:ENSTGUP00000016762} KW=Complete proteome; Reference proteome OX=59729 OS=Taeniopygia guttata (Zebra finch) (Poephila guttata). GN= OC=Estrildidae; Estrildinae; Taeniopygia.
Sequence length 123
Sequence
YLASDHKTFRDFAKKSRLQKVFLTAELSYLTFWQAKSLDPQLRLEHEGFPVPAETKIIIT
HCYTNRNLAVPRTFCVWSHFGREFEVICHNYLDSRRVEEDKNHWEIITGNPGPEDGTMLE
RPK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]