dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H2JND5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H2JND5|H2JND5_STRHJ) Uncharacterized protein {ECO:0000313|EMBL:AEY88403.1} KW=Complete proteome; Reference proteome OX=1133850 OS=Streptomyces hygroscopicus subsp. jinggangensis (strain 5008). GN=SHJG_3129 OC=Streptomyces.
Sequence length 324
Sequence
MPPLSPLLGARRAPTEPSGETAEDASGAFDAALDDAELGAARAALAQGRRQAARSLLVHT
GDDWDRRGHRLTVLAQDARAAAWATDWLTAEPGSADATTLLALALVHRALRGEEEPGPAR
EACDTAAALAPDDPTPWLGRLRLARALAPEREVLAAFAEVRRRHPEHHHAHHLLIARLAE
RPVGGRAEAHEVYDLAEQAAAEAPADSPLAVLPVVAYAERYRVLAAAGLAPADPAACGHW
SGPRARRILRACFDWWLEWEHDEHPRRHVDLNHLAFALSRAGRPAEAAALFRRIGVHATP
APWSYAHPDPLAAFRAARAHALGH

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]