dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H2MJZ7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H2MJZ7|H2MJZ7_ORYLA) Integrin beta 1 binding protein 1 {ECO:0000313|Ensembl:ENSORLP00000019001} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN=itgb1bp1 OC=Oryziinae; Oryzias.
Sequence length 198
Sequence
MFRKVKKRHSSSSSQSSEISTKSKSVDSSFGGLSRSSTVASLDTDSNKSSGNSTSETCAE
FRVKYVGSIENLEFEMSRSLQEPLDLINYIDAAQQDGKLPFVPGDEEMILGVSKYGVKVA
SLDQCDVLHRHPLYLIVRMLCYDDGLGAGKNLLALKTTDAKQEECSIWVYQCSSSEQAQS
ICRVLSTSFDCALVSDKS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]