dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H2MV82 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H2MV82|H2MV82_ORYLA) Human immunodeficiency virus type I enhancer binding protein 2a {ECO:0000313|Ensembl:ENSORLP00000022708} KW=Complete proteome; Reference proteome OX=8090 OS=Oryzias latipes (Japanese rice fish) (Japanese killifish). GN= OC=Oryziinae; Oryzias.
Sequence length 2251
Sequence
MDPHDSTVTRQKGSNRDEVKEKIPLQRKWASEPSANTKQNTFCDPEVKHRESLPCGAMRG
STPQQKYPMTGNPVQLLSGPSGVGAIGGPPSADPQGPLTQGFPRGYPYQLGQPYPQHPQT
ERFISGAKPQPGLESHAWPFAGQLPSDDPYGHPGHTHLHKAGRFPRQKSPSLPSSFGQYS
QSGLEPGEEGYSKKEQKPKKPGKYICHYCGRACAKPSVLKKHIRSHTGERPYPCEPCGFS
FKTKSNLYKHRKSHAHAIKAGLVPFSSELAVTHSEDVGQASPVGEGEAPSDGEQSTDTDE
EGVEGSTMLMEKHSPIPQISFEANKTAGGGEPAYADSAEEFHIGSMKVPILIFPKPGVVP
PGGMDCPTFHDAKVSHHMLASQAGGRSHSLDDSSSSKRLAQRMDEKKVQDSDPSISQSLN
LLSPHSKGSTDSGYFSPYDSAELQIGTPNTSAKTYEEIMFGRTWYNRPNSRPRQSMTVGM
AAADGNGSLKQQDLDMCKIAEDPSSFKESLGMSGDAKKYPTGPCQSSTGLLEPPSESGTL
IRSRSMPAPVPSNLNTPQGIRGSISFDNMVPADDVFYPPGQPKLKRQSAFEHPANESHPG
EAEGHPHMAKGLASSVGLKITERCPGGPEDIFYNQHPSRVSISEIATRKRRKEKSVGDDE
DSPENCDSSFSSSVDIIGDYDFKQGSFDGSRGTPTGKSSFHSTHSQSDSFDTCVSMCSDD
IVPFPDSEGRKPAGNVISVIQHTNSLSRPNSFEKSESFEQPVHQPSDKAPSSQYSEQSDT
DIYEDALSPESALQRAESMEQQQSDSDLASFSSSSAAASPGQPYHKLVRQPNIQVPEIRV
TEEPDKPEKDTEPLVTKEPEKQPPAVEEFQLPQRSDTLSQMPTEKLPPKKKRLRLADMEY
SSGESSFESTCTSLSRSPSQESNLSHSSSMSMSFEKDEGVKSVSPTKQEDSLANGSGAKQ
SEFLTVPSSFSSHHQQREMRRSSSEQAPCTLPTELPEMRSKSFDYGSLPSCRQGEVYTST
SAKKERRRGYLVRQASLSVYPEGVLQDIGGGQVSIKQENLEHGVWPIPSGSPHSSSEMAI
RTRRPGNITVVGSHQQPPQHVFRQSISDDSLQDEPCFGRPKQHRLQAQGSSSEGEHPVLE
VRNRDLIQQYQGGVPFAPFSQPCAFWNQEAEKAARQQQQLQKLHLRSPSSLPGPAAPKQS
AQQVYDPQLYEGKTEHQSTHIYSPSFPSHINMLSPANSVLQRHLQPTQNLSSKTTSPGLV
VPVRIQTYVPVFGSATYTSVSQFMSCHANEADALGADRCENSTLGGVRPCNPPGGISRSG
FNLSLLLGHTDSDLLRSSFWKGSEKHLNTGIPLSLTSGTISTTDASGSAIGGGKRMLSPT
SSLELFIQSKQQKRVKEERMYGQIVKEMSAVELSGAERGTTPEKQGGSNQRAPLRSKDSV
DECERMSSSPPLSDPPAATKIAVPVRSSAPHLSDVPQGDSFPPPLQIVTERGLVSCSQDS
PERLDVDDVSPGPSSSPEPMLSSSDAESSDKQALLLKPAPTHSSGMTGGAQSLLFTNLSE
VQQLLHFPSLRTTSRVSWCFRNYTKPNSTQAASHCSVYSSWSVSTHNPNPLNISTKAALA
LLRSKQRENTEWLFTLAAMCPPSSGKLVSSVAWKLMFDQLKPDLGPADLNCFGRKMKGVE
SWERSKVELGEKVASAKQLSTEPTRIKIFEGGYKSNEDYVYVRGRGRGKYICEECGIRCK
KPSMLKKHIRTHTDVRPYVCKFCNFAFKTKGNLTKHMKSKAHIKKCLELGVSMSSVEDTE
AEELTQTEIVSHFLLSFRADKQAVDKNLSQFTSKEGQRRHKCQSDSDRQEGDSTPKTGSR
SCSPQLYALPPMSIAHVATLNPAPHLLHPTATDLLGTPPRPPLLGYFTTVPSIQITPQAQ
PSDAAGRERLQAEDPGCQLQPLGSRLLALPSSSMDEDLPDLSSPSSRLSSPGLEPPGCPS
PISPSSSPSTHRYLSPCRNLSPSARHLSPRRDISPLRHISTAGGYRRDLSPRRRHAVVSP
LSRPLSPRGRDYKRDLSPQGQHKRMIRHVSPCRGPLHQSFVVPKSLIFQKRSKLFLGINV
KLLSRCVDEKIQKHFRSNQNNLSSAPLQVLFSHLPLHSQFPMPSSLPLIPIGGIHMVNFA
PTPIGSCLDQQGGASAVSHLTLQKSTSEDSNCGEANFPHFSSISKRRGPAEGQGAREASS
PQQREGGGVRLEQEEGIQTCTQAIASLCIDS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]