dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H2SAH5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H2SAH5|H2SAH5_TAKRU) FinTRIM family, member 82 {ECO:0000313|Ensembl:ENSTRUP00000009401} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN=LOC101074420 OC=Takifugu.
Sequence length 564
Sequence
MADHTSPDYFSCTLCLSLLRDPVAIPCGHSFCMDCISGYWNEADYTGIYICPQCKITFTQ
RPVLRPNATLSMVAEKIKKSGLNLNANAAQDSVYAGASDVPCDFCMGKKLKAVKSCLNCL
ASYCEKHLKPHYESATFKRHKLVDELGNLDRKICPQHQKSLELFCRTDQMCICAICTVSE
HRGHDIVSAEAERSEKQKLLGVSQAEIRQKCQERVKELEELKTAVDSLKNSAQRAMVESQ
KMFEDMIRSIDRMRSEVTKLIGINEKAAFNQAEALIERLEQEIDELKKKESGLKQLYGTD
DHIHFLQNFNYLCTPTDDGFIPRVSLNPDFSFAAVRKAVAEIKERLEECDSSDGGTQTRE
ASVLINENVACVAVSEMPVYTTESRTLDRRSRGERQVNDPLADFCQLKLDPNTAYKELYI
SENSRKVIRTRDLQPYGDTSDRFDSFAQVLCREALSGGRFYWEIEWNGEFSIGVAYRSIS
RKGKGSMCLLGYNDKSWSLLCSDTGYSAWHNRVDKSISAPHSPRIGVYLDHSAGVLAFYS
ISGSMTLLHRFETTFVEPLYPGFG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]