dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H2V630 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H2V630|H2V630_TAKRU) Caspase 8, apoptosis-related cysteine peptidase, like 2 {ECO:0000313|Ensembl:ENSTRUP00000044664} KW=Complete proteome; Reference proteome OX=31033 OS=Takifugu rubripes (Japanese pufferfish) (Fugu rubripes). GN= OC=Takifugu.
Sequence length 519
Sequence
MDFQARLLKVGNDLRKDEVRALVFLCSDILGCNPAAVQSAGDLFSRLSDQDHLSEEQPHL
LVELLGIIQRTKLLRDHNLPRTGAQDLISPYRKLLYSLSEELTADDLKDIKFLLNNKLPR
GKLEEVTTLEVFMELEHRALISDTDLGFLESIIQPVCPVLLEKINQFNAQNCKFYLFTIF
KLQDASDPLKALWLIKKFDSFLVSFSSNESWIGGSVVLFQHPAGKPDLPRSGDVRDRQRR
CSKYENPNPEVLVLSAVGCPDVSVQGVETYLMTAAKRGRCLIINNCNFRVSRLKKREGTM
VDEASLDKVLKWLGFEVEIQRDCTSKKMSSLIQELAKTSQRDWDCVMCCVLSHGLEGGVY
GVDGGTVEIRKLMEPFSGTNCPSLAGKPKIFFIQACQGSRQQDIVYTDAGTPGHGYVDNN
AVQAKECIPSHADFLLGMATVPSFVSFRDGTHGTWYIQSLCQNLADMVPRGCDLISILTK
VNADVSKKVAWIDSGHKTQMPQPAFTLTKKIVFPAPNTP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]