dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H2ZBG3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H2ZBG3|H2ZBG3_CIOSA) Uncharacterized protein {ECO:0000313|Ensembl:ENSCSAVP00000014928} KW=Complete proteome; Reference proteome OX=51511 OS=Ciona savignyi (Pacific transparent sea squirt). GN= OC=Phlebobranchia; Cionidae; Ciona.
Sequence length 529
Sequence
MIDDLFDGVEFEESRSPSPFAPTLTRQKSKLEIKCELSVRKQTCNEAEDTHMVTRQPSRR
PLARSTSSESVVSLGAEKKATPFPISIDSYRTEKRKSLRKQSDNKKVVRNESVQSVAPPR
AATVKEKIGGMMEEIQQQQRVIQQASAALNCCYDAHHGKGSITELEAEKLLLIASEKRLA
LLAEVQALKSRSVTEPPQTVQPCLGNLTIRNLRLPLRTEYIFSMASKKDCGDIRSHYYFL
LVRCGPTRILASHLASTHDSLSGDSLVFSDEFKLVDLESNFDITIEVYSVTHRSRADGVP
NQEKSKRKLSGILHKSLTPRKLRSRSHMTMTHTSSPGGPNAIRISSFSLIGAVSINLNDV
KSEKFTLQKVPFLSPISGHFACKIEADFQSNVEQRGFLTMFDDVGGLGAWHRRWCALIRG
VLFSWTYPDDEKYKEALCKIDLTSCISERIRTVERIMCARPNTFELRTMRPRRHGDKDNL
ITQDTGSVITTKHWLAADTKDERIAWIESMNQALADVRAWDTNALKPLK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]