dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H3CY88 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H3CY88|H3CY88_TETNG) Potassium inwardly-rectifying channel, subfamily J, member 1a, tandem duplicate 6 {ECO:0000313|Ensembl:ENSTNIP00000013223} KW=Complete proteome; Reference proteome OX=99883 OS=nigroviridis). GN= OC=Tetraodon.
Sequence length 342
Sequence
MFRFVSKCFRDCLAERRHRRTRLVTKDGRCNIEYGNIKYSNHFALLADFWTTFVEIRWRF
VLFLFIAAFTLSWFLFGLLWYWIARTNGDLAWQNPPSNHTPCVDNVVGLTTAFLYSIETQ
TTIGYGGRALTHLCPGAVSLLVIQSLIGAIINCFMCGVILSKISLPTQNPDDGSQIYGKL
LRTTNTPDGETIIMDQVNIEFMVDAGKDNLFFVCPLTLYHVIDKSSPFFDMAVDTLHKQE
FELVVFLDGTAESTSSSCQVRTSFIPQEIMWGYNFLPIISRSKEGRYRVDFSNFSKVVPV
ATAHCAYCFHNIKGHHHHSRDGHDNKGFEVIEIQDPPSVTKM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]