dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H4JD24 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H4JD24|H4JD24_ECOLX) 2,4-dienoyl-CoA reductase {ECO:0000313|EMBL:EHU19485.1} KW=Complete proteome OX=868136 OS=Escherichia coli DEC1D. GN=ECDEC1D_3942 OC=Enterobacteriaceae; Escherichia.
Sequence length 672
Sequence
MSYPSLFAPLDLGFTTLKNRVLMGSMHTGLEEYPDGAERLAAFYAERARHGVALIVSGGI
APDLTGVGMEGGAMLNDASQIPHHRTITEAVHQEGGKIALQILHTGRYSYQPHLVAPSAL
QAPINRFVPHELTHEEILQLIDDFAHCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQR
SDQWGGDYRNRMRFAVEVVRAVRERVGNDFIIIYRLSMLDLVEGGGTFAEMVELAQAIEA
AGATIINTGIGWHEARIPTIATPVPRGAFSWVTRKLKGHVSLPLVTTNRINDPQVADDIL
SRGDADMVSMARPFLADAELLSKAQSGRADEINTCIGCNQACLDQIFVGKVTSCLVNPRA
CHETKMPILPAVQKKNLAVVGAGPAGLAFAINAAARGHQVTLFDAHSEIGGQFNIAKQIP
GKEEFYETLRYYRRMIEVTGVTPKLNHTVTADQLQAFDETILASGIVPRVPPIDGIDHPK
VLSYLDVLRDKAPVGNKVAIIGCGGIGFDTAMYLSQPGESTSQNIAGFCNEWGIDSSLQQ
AGGLSPQGMQIPRSPRQIVMLQRKASKLGQGLGKTTGWIHRTTLLSRGVKMIPGVSYQKI
DDDGLHVVINGETQVLAVDNVVICAGQEPNRALAQPLIDSGKTVHLIGGCDVAMELDARR
AIAQGTRLALEI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]