dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H6PTY1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H6PTY1|H6PTY1_RICP3) ATP-dependent helicase Rho {ECO:0000256|HAMAP-Rule:MF_01884} KW=Complete proteome OX=481009 OS=Rickettsia philipii (strain 364D). GN=RSA_03870 OC=Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
Sequence length 458
Sequence
MNTTNKESTAELNNTESNNNYNNFAENGNIINLKQLKRKLPEELQAQAEELKIENINSLL
KQELVFAILKKSVEQGVLIVGEGVLEVLPDGFGFLRSPEVNYLAGPDDIYISPSQIRRFG
LRTGDTVEGQIRAPKAGERYFALLKVNRVNFEDPSKAYHRVHFDNLTPLYPDEKLGLELE
NNSKDSKDFSTRVIELVAPMGKGQRALIVAPPRTGKTVLLQNIAHAITTNNPEVFLIVLL
IDERPEEVTDMQRSVRGEVVSSTFDEPASRHVQLAEMVIKKAKRLVEHKKDVVILVDAIT
RLARAYNTVVPSSGKVLTGGVDANALQRPKRFFGAARNIENGGSLTIIGTALIETGSRMD
EVIFEEFKGTGNSEIVLDRKIADKRIYPAIDITRSGTRKEDLLVDKIILNKMWVLRRIID
PMGSSEAIEFLLKKLENTKTNGEFFEMMKSPERPKNGL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]