dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H6RS38 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H6RS38|H6RS38_BLASD) Transcriptional regulator, GntR family {ECO:0000313|EMBL:CCG04232.1} KW=Complete proteome; Reference proteome OX=1146883 OS=Blastococcus saxobsidens (strain DD2). GN=BLASA_3364 OC=Blastococcus.
Sequence length 234
Sequence
MAECPGDDRAFMTKGDVAYARIRTLILSGELAAGAVLPQAALARTIGMSTTPLREALRRL
KQEGLVELDAHRDARVRPLDATEARDLLELRSALDPLAASLAAHRRTDADLAEIAAALAG
LEALTTHPSAAQLESHHRFHAAVHRASHNALLVQTLDGLWVKTDRYRRHALEVGRSEADR
HARATEHRLVLEAVRDRDAEAAAERMRRHVETSLGARSADRLADEGAGTDRSTT

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]