dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

H6SHX8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|H6SHX8|H6SHX8_CLOTM) Anti-sigma factor {ECO:0000313|EMBL:CCF82156.1} OX=1515 OS=Clostridium thermocellum (Ruminiclostridium thermocellum). GN=rsgI1 OC=Ruminiclostridium.
Sequence length 486
Sequence
MNRLGIIYEIQGMKAVVLTSEGEFLIIRRRKDMKVGQQVSFENEDIYNVRGKRFLYVAAA
VSSVAAVLVVMFLYFQSAFLSNTDNIYGYICVDINPSVELVIDETCRVLEVRPQNKDGEQ
LISGLELLDKNVEDVVYELINRSISFGFVKADDNRKIVLISGALNDKRNELKTKKENDEA
ELTELLDNIKARVDRIDNIKVRTITATSRERKDALKYGLSMGKYCLYLEAQELNGSITID
EVHDMSISDMIEKLEQMKLALKDEASPKLQTTPTLGGETAQISPESMQHSTVPGLPETPS
SSEKTIAPTLHGTPGVPDEKTLQPSTPTESSEYVQDGTKGLKIQYYSRKPHDSAGIDFSF
RMFNTGNEAIDLKDVKVRYYFKEDVSIDEMNWAVYFYSLGSEKDVQCRFYELPGKKEANK
YLEITFKSGTLSPNDVMYITGEFYKNDWTKFEQRDDYSYNPADSYSDWKRMTAYISNKLV
WGIEPN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]