dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

I1WZW2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|I1WZW2|I1WZW2_ECOLX) Uncharacterized protein {ECO:0000313|EMBL:AFI72845.1} OX=562 OS=Escherichia coli. GN= OC=Enterobacteriaceae; Escherichia.
Sequence length 891
Sequence
MVGSRWYKFDFHNHTPASHDYKIPDISPREWLLAYMKQHVDCVVISDHNSGAWVDVLKGE
LENMSRDASTGDLPEFRPLTLFPGVELTATGNVHILAVLHTHSTSADVERLLAQCNNNSP
IPSEVPNHQLVLQLGPAGIISNIRRNPKAVCILAHIDAAKGVLSLTNQAELTAAFQESPH
AVEIRHRVEDITDGTRRRLIDNLPWLRGSDAHHPEQAGMRTCWLKMSSPDFDGLRHALLD
PENCVLFDQLPPEEPASYLRSLKFRTRHCHPVGQDSASVEFSPFYNAVIGSRGSGKSTLI
ESIRLAMRKTEGLTATQGSKLDQFIRTGMEADSFIECIFHKEGTDFRLSWRPDSKHELHI
FSDGEWMPDSHWSADRFPLSIYSQKMLYELASDTGAFLRVCDESPVVNKRAWKERWDQLE
REYLNEQITLRGLRARQGSADSLRGELSDAERAVSQLQSSAYYPVCRQLALARNELSAAT
LPLEHFERRIAAIQALAEEPLQRSDIPPEPSGLLMAFMARLSSVQQQYDQRLNTLLAEYA
AELAGIRREQSFIALRTAVSDQETNVESEAVSLRARGLNPDVLNELMARCESLKNELRNY
DGLDGAISASVARSEQLLAEMRAHRMALTDNRKAFLSSLSLSALEIKILPLCAPYEDVIS
GYQTVTGISNFAERIYDNSDGSGLLSDFISERPFSPLPAATEKKYRALDELKALHHSIRL
DNSEAGAGLHGSFRNRLRSLNDQQLDALQCWYPDDGIHIRYQTPGGQMEDIAFASPGQKG
ASMLQFLLSYGTDPLLLDQPEDDLDCLMLSMSVIPAIMSNKKRRQLIIVSHSAPIVVNGD
AEYVISMQHDRTGLYPGLCGALQEAPMKALICRQMEGGEKAFRSRYERILS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]