dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

I3IZK2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|I3IZK2|I3IZK2_ORENI) ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) {ECO:0000313|Ensembl:ENSONIP00000002042} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=arfgef2 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence length 1846
Sequence
MQQHRPPQQQQYSQSKAENSKTKSMFLSRALEKILSDKEVKRSQHSQLRKACQVALDEIK
EELEKQKDGTVVPPRANYIEADKYVLPFELACQSKSPRIVSTSLDCLQKLIAYGHITGNA
PDSRTPGKRLIDRLVETICNCFQGPQTDEGVQLQIIKALLTTVTSPHIEIHEGTVLLTVR
TCYNIYLASRNLINQTTAKATLTQMLNVIFTRMENQAALEAQEQEKERLRLPQQNPSPVP
SSRRSGSPRSDHTSTPEPQNSPSPAASTPDLTTNTSSSTHPSPAPDLDQDQEPDTPSVNG
EVESENTPPNGEAEQVTPSTDSVFEEEGAETSPTAAQQGDEGDKPESNSNPAEKGEQQPT
QTHVGAGGEHPPHPATEQTEVAPPRVRTEGQQMNGIIEDRSSLSSTDMLDAEALQGPHNA
ARFSHILQKDAFLVFRSLCKLSMKPLADGPPDPKSHELRSKIVSLQLLLSVLQGAGPVFR
THEMFVNAIKQYLCVALSKNGVSSVPEVFELSLAIFLTLLSHFKVHLKMQIEVFFREIFL
TILETSTSSFEHKWMVIQTLTRICADAQCVVDIYVNYDCDLNAANIFERLVNDLSKIAQG
RSGQELGMTPLQELSLRKKGLECLVSILKCMVEWSKDMYVNPNLQANLGQEHPSDSEGAE
LKLPEQLAGRRDSISSLDSAISSSVAASQADHPEQYEVIKQQKDIIEHGIELFNKKPKRG
IQYLQDQGMLGPKAEDIAQFLHQEDRLDTTQVGEFLGENIKFNKEVMYCYVDQLDFCGRD
FVSALRMFLEGFRLPGEAQKIDRLMEKFAARYLECNQGQTLFASADTAYVLAYSIIMLTT
DLHSPQVKNKMTKEQYIKMNRGINDSKDLPEEYLSSIYDEIAGKKIAMKESKEFSITPKS
TKQSVASEKQRRLLYNMEMEQMAKTAKALMEAVSHAQAPFFSATHLEHVRPMFKLAWTPL
LAAFSVGLQDCDDPEVASLCLEGIRCAIRIACIFSMQLERDAYVQALARFTLLTASSSIT
EMKQKNIDTIKTLITVAHTDGNYLGNSWHEILRCISQLELAQLIGTGVKTRYISGVVRDR
EGGIKGLPSGTEEFMPLGLGNLVGSQDKRQMAHIQESVGETSSQSVVVAVDRIFTGSTRL
DGNAIVDFVRWLCAVSMDELASAHQPRMFSLQKIVEISYYNMNRIRLQWSRIWQVIGDHF
NKVGCNPNEDVAIFAVDSLRQLSMKFLEKGELANFRFQKDFLRPFEHIMKKNRSPTIRDM
VIRCVAQMVNSQAANIRSGWKNIFSVFHQAASDHDETIVELAFQTTGHIVLNTFREHFAA
AIDSFQDAVKCLSEFVCNAAFPDTSMEAIRLIRHCAKYVSDRPQALREYTSDDMNVAPGD
RVWVRGWFPILFELSCIINRCKLDVRTRGLTVMFEIMKSYGHTFEKHWWHDLFRIVFRIF
DNMKLPEQQTEKTEWMTTTCNHALYAICDVFTQFYEPLSEILLADIFTQLQWCVRQDNEQ
LARSGTNCLENLVILNGEKFSPEVWDITCSCMLEIFQNTSPQALLTWRPAGQDEEAADAK
HFDADFDTQSQSSYDRALSERGHSQMSSDDTWKGRSNARVSDQRLFAGLLIKCVVQLELI
QTVDNIVFYPATSKKEDADNMAAAQRDALEESEAEGRESGPDQGMYRHMTSAHLFKLLDC
LLESHTFAKDFNSNNEQRTALWRAGFKGKSKPNLLKQETSSLACSLRILFRMYSDPQLQD
SWPDIQTRLLLVCNEALGYFISLTSESHREAWNSLLMLLLTRTLRLPDDKFKPHASCYYP
HLCEMMQFDLIPELRAVLRRFFLRIGSVFHIAAAHPEGAPARTPAS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]