dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

I3JCE5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|I3JCE5|I3JCE5_ORENI) Kelch like family member 4 {ECO:0000313|Ensembl:ENSONIP00000006535} KW=Complete proteome; Reference proteome OX=8128 OS=Oreochromis niloticus (Nile tilapia) (Tilapia nilotica). GN=KLHL4 OC=Pseudocrenilabrinae; Oreochromini; Oreochromis.
Sequence length 731
Sequence
MSVSGKKEFDVKQILRLRWRWFSHSSQGSAGGGGGGVGGGGGYIQQDGLDHRGTPVQGRL
KSHSRERGVGGLRKTNSPVHSILAPTPGPTPVYVRAGHQSWHHQQSTIQGSQASEDSSKN
SSSPSTTRKDDTNTGQEDVKSSTEDPAELEARERITKHLLSKMNTNSSDEFFQATNHAEQ
TFRKMETYLQHKQLCDVLLIAGDHKIPAHRLVLSAVSDYFAAMFTSDVREAKQEEIKMEG
VDPEALRSLVHFAYTGVLELKEETIESLLAAACLLQLSQVIQVCCNFLMKQLHPSNCLGI
RSFADAQGCVDLLNVAHNYTMEHFLEVIQNQEFLLLPTAEIVKLLSSDDINVPDEETIFQ
ALMMWVRYDVQNRQQDLGVLLAYIRLPLLPPQLLADLENNKMFSDDLECQKLLMEAMKYH
LLPERRPMFQSPRTKPRKSTVGALYAVGGMDATKGSTTIEKYDLRTNTWVQVGVMNGRRL
QFGVAVIDNKLYVVGGRDGLKTSNMVECYNPVTKVWSTMPPMSTHRHGLGIAVLEGPMYA
VGGHDGWSYLNTVERWDPQARQWNYVASMSTPRSTMGVTALNGKLFAVGGRDGSSCLRSM
ECFDPHTNKWSMCAPMTKRRGGVGVATYNNFLYAVGGHDAPASNHCSRLSDCVERYDPKT
DTWTTVAPLSVPRDAVGVCLLGDRLYAVGGYDGQSYLNTVESYDAQNNEWTEEVPLNIGR
AGACVVVVKLP

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]