dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

I3N544 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|I3N544|I3N544_ICTTR) Potassium voltage-gated channel subfamily A member 4 {ECO:0000313|Ensembl:ENSSTOP00000019490} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=KCNA4 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence length 654
Sequence
MEVAMVSAESSGCNSHMPYGYAAQARARERERLAHSRAAAAAAVAAATAAVEGSGGSGGG
SHHHHQTRGACTSHDPQSSRGSRRRRRQRPEKKKVHHRQSSFPHCSDLMPSGSEEKILRE
LSEEEEEEEEEEEEEEEGRFYYSEDDYGEESSYTDLLPQDEGGGGGYSSVRYSDCCERVV
INVSGLRFETQMKTLAQFPETLLGDPEKRTQYFDPLRNEYFFDRNRPSFDAILYYYQSGG
RLKRPVNVPFDIFTEEVKFYQLGDEALLKFREDEGFVREEEDRALPENEFKKQIWLLFEY
PESSSPARGIAIVSVLVILISIVIFCLETLPEFRDDRDLVMALSAGGHSGLLNDTSAHHL
ENSGHTIFNDPFFIVETVCIVWFSFEFVVRCFACPSQALFFKNIMNIIDIVSILPYFITL
GTDLAQQQGGGNGQQQQAMSFAILRIIRLVRVFRIFKLSRHSKGLQILGHTLRASMRELG
LLIFFLFIGVILFSSAVYFAEADEPTTHFQSIPDAFWWAVVTMTTVGYGDMKPITVGGKI
VGSLCAIAGVLTIALPVPVIVSNFNYFYHRETENEEQTQLTQNAVSCPYLPSNLLKKFRS
STSSSLGDKSEYLEMEEGVKESLCAKEEKCQGKGDDSETDKNNCSNAKAVETDV

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]