dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

J9EEP6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|J9EEP6|J9EEP6_WUCBA) Uncharacterized protein {ECO:0000313|EMBL:EJW75502.1} KW=Complete proteome; Reference proteome OX=6293 OS=Wuchereria bancrofti. GN=WUBG_13590 OC=Spiruromorpha; Filarioidea; Onchocercidae; Wuchereria.
Sequence length 279
Sequence
KGCEPCECDPTGVILSDNGMPQLQCNELDGRCYCKPGRGGRTCSDCEDYHWGDPATGECR
KCECDRIGSATQQCDRNNGSCVCLPGSGGPLCNMCARGYTGQWPQCQACGECFQNWDEII
QNLRSQVEVLIETAKNVEDTGVASVYDNEFEKWKTINLKKELLNSVGGRITEISSNVDGA
DLELKSLVEEADRLTEKSQAFQENATLLRVADIQGAYNITRESAEKSSAAKLRTDQADLK
ITSAESSRQEATQLLDNNQLDFEKQFSENEMALVRIDKQ

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]