dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K4CID7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K4CID7|K4CID7_SOLLC) Uncharacterized protein {ECO:0000313|EnsemblPlants:Solyc08g006490.1.1} KW=Complete proteome; Reference proteome OX=4081 OS=Solanum lycopersicum (Tomato) (Lycopersicon esculentum). GN=101253303 OC=Solaneae; Solanum; Lycopersicon.
Sequence length 276
Sequence
MKIPPKKPHFFKPIQPGFKNGLKIPIGFLKYLKGNDNVEHAILKRGGYKWSMKVNGHRFE
AGWVEFVEQHGLKLGNILMFRHEGNMEFEFSIFDSSHCDREYVEYMEEVGDHTREEISKK
FKFKEDATERPRQKIKSSRKTSSHIIKVANHHKSFGHSHVECTIREYNISRGYLHLPRQF
AYANGLANKKCDLIIRDERQRSWNVKLSSSKTRSYISGCGRTKFFADNCLNKGDCIMFEV
VTNGETPIWKFQVTYREVPLQMFQGKFSHVTNLLFL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]