dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K7FQE8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K7FQE8|K7FQE8_PELSI) Tyrosine-protein phosphatase {ECO:0000256|PIRNR:PIRNR000927} KW=Complete proteome; Reference proteome OX=13735 OS=Pelodiscus sinensis (Chinese softshell turtle) (Trionyx sinensis). GN=PTPN4 OC=Pelodiscus.
Sequence length 949
Sequence
MDLILKTVLVPRCTDLVWTVMTARFRLPAGRTYNVRASELARDRQHTEVVCNILLLDNTV
QAFRVNKHDQGQVLLDIVFKHLDLTERDYFGLQLADDSTDNPRWLDPNKPIRKQLKRGSP
YSLNFRVKFFVSDPNKLQEEYTRYQYFLQIKQDILTGRLPCPYNTAALLASYSVQSELGD
YSHSENLPGYLSDYSFIPSQPQDFEKEIAKLHHQHIGLSPAEAEFSYLNTARTLELYGVE
LHYARDQSNNEIMIGVMSGGILIYKNRVRINTFLWLKIVKISFKCKQFFIQLRKELHESR
EMLLGFNMVNYRACKNLWKACVEHHTFFRLDRPLPPQKNFFAHYFTLGSKFRYCGRTEVQ
SVQYGKEKANKDRVFARSPSKPLARKLMSGMDWEVVSRNSLTDDRLETQSLPSRSPPGTP
NHRNSAFTQERARLRPSSVGHLVDHVVHTSPSEVFANHRSPSSTQANSIILESSPSQETP
IDGQPPALPPKQSKKNSWNQIHYSHSQQELDNHINETFDVSSSPEKSTPNGGVPPDNLVL
IRMKPDENGRFGFNVKGGSDQKMPVIVSRVAPGTPADLCVPRLNEGDQVVLINGRDIAEH
THDEVVMFIKESCERHSGELVLLVRPNAVYDVVEEKLESEPDFQYIPEKSPLDAVHQDDN
ALRESMIQLSEGLITGTILAQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVI
LKSNDDYINANYINMEIPSSSIINQYIACQGPLPNTCPDFWQMTWEQGSSMVVMLTTQVE
RGRVKCHQYWPEPTGSSSYGNFQIACHSEEGNPAYVFREMTLTNLEKNETRQLTQIQYVA
WPDHGVPDDSSDFLDFVCLVRKKRAGREEPVVVHCSAGIGRTGVLITMETAMCLIECNQP
VYPLDIVRTMRDQRAMMIQTPSQYRFVCEAILKVYEEGFVKPLKTSLHK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]