dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9PVQ6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9PVQ6|K9PVQ6_9CYAN) Biosynthetic arginine decarboxylase {ECO:0000256|HAMAP-Rule:MF_01417} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_0167 OC=Leptolyngbya.
Sequence length 642
Sequence
MAISPSQSPDEHSWSVQDSERLYQIQGWGEPYFGINAAGHVQVAPTGEAEHGVDLFELVE
KLKNQGIQLPCLLRFPDILSDRLKRLNECFAQAIARYGYEGEYQGVYPIKCNQHRPVVEA
LLEAGQPYRFGLEVGSKPELMIAIAMLEPTSDHQPLLICNGYKDRDYIETALLATQLGHR
ALIVIEQPEELDLTLSASQALEIRPALGIRAKLASQGIGRWGSSSGDRAKFGLTVPQILQ
IVQTLRDKNSLDCLQLLHYHIGSQLSSIGVIKAAIREASQIYAELVLLGANVKYLDVGGG
LAVDYSGSKNNVPASKNYNMQNYANDIVATVKDSCDEKQVPAPTLVSESGRAIASHQSIL
IFDILSSSDITPTLPPEPSHREHLVIRNLRETYDFITLENYQETYHDAMQFKEEAISLFS
LGYLTLGDRGTAEQLYWCCCEKIFQIMQTAVSIPTDLQDLWQNMATIYYGNLSIFQSIPD
SWAINQLFPIMPIHRLDKRPNRRGIIADLTCDSDGRFNQFIDIKTKHKNLLELHPLNDKP
YYIGLFLMGAYQDIMGNFHNLFGRTNAVQVRLTEKGHSIDSMTQGSTVENILETVQYKHQ
ELLEKIKTQVDSAANRQKINIEQAQYLIDRYENNLKGYTYLN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]