dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9Q1T6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9Q1T6|K9Q1T6_9CYAN) Ribulose-phosphate 3-epimerase {ECO:0000256|PIRNR:PIRNR001461} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_2777 OC=Leptolyngbya.
Sequence length 229
Sequence
MTDKKIAISPSILSADFSRLGEEIKAVDEAGADWIHVDVMDGRFVPNITIGPLIVEAIRP
YTKKPLDVHLMIVEPEKYVANFAKAGADIISVHAEHTASPHLHRTLCQIRELGKKSGVVL
NPSTPLDIIEHVLDVCDLILIMSVNPGFGGQSFIPSMVSKIEKLRAMCDERGLDPWIEVD
GGIKPNNAWQVIDAGANAIVAGSAVFKADDYADAIEGIRNSKKPEAVAA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]