dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9Q393 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9Q393|K9Q393_9CYAN) Phosphoribosyltransferase {ECO:0000313|EMBL:AFY39544.1} KW=Complete proteome; Reference proteome OX=111781 OS=Leptolyngbya sp. PCC 7376. GN=Lepto7376_3326 OC=Leptolyngbya.
Sequence length 156
Sequence
MVDRVISWTEYHQTIEKLAEQIQTSGWEFNQILCLAKGGLRVGDILARIFDQPLAILNVS
SYGGNDNRQQSQIRFAEHLTNFGELGDRLLLVDDLVDTGVSLERTLDWLQNYAPHLIEIR
TAVLWYKARSHAKPDYFVEYLEHNPWIQQPFEHYEK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]