dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9R110 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9R110|K9R110_NOSS7) Subtilisin-like serine protease {ECO:0000313|EMBL:AFY51019.1} KW=Complete proteome; Reference proteome OX=28072 OS=Nostoc sp. (strain ATCC 29411 / PCC 7524). GN=Nos7524_5296 OC=Bacteria; Cyanobacteria; Nostocales; Nostocaceae; Nostoc.
Sequence length 616
Sequence
MRKLIILCLFVIGLVSAVFGFLNFQGLAAKGEFETILLDFREDIPAEVIKQDLQAIAQKY
NVTPQLDNKFSAQDNVYIIKGDRDRLKELKKSPFAKATEIIEPNYIYKLIEPAAKPTWLG
ELLRPQDSEEVQPSLTAPNDEYYSKQWNLHKIGVESAWSQTKGSGVTVAVIDTGVTKVRD
LYETKFVKGYDFVNDKEEASDDNGHGTHVAGTIAQATNNKYGVAGIAYEAKLMPLKVLSA
YGGGTVADIAEAIKFAADKGADVINMSLGGGGESQLLKQAIDYAHSKGVVIIAAAGNENE
NSAAYPARYPYVIGVSAFGPDGEKAPYSNFGAGVDISAPGGTDAGAILQETINEEGESVF
LGLQGTSMASPHVAGVAALVKAKGIQEPEEILKVLKQSARVIKDDSLNYYGAGQLNAEAA
VKLATDGQISFQDFFRWLRDNGYLNPGFWIDGGAVALLPKILMVVGSYLLAWFLRVYFPF
AWSWSLSSGLIFGSSGLFFLQGIYIFDLPQWPFRVLGSSIPELGNTIQGTGALNPIFASV
LIPIVLMALLLGHPNWKWFAIGSTLGVAACLTVSAVLDPAVWGLGSENLARIFLIANALL
CYGLARLALKNEGQTA

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]