dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9RDW1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9RDW1|K9RDW1_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFY55519.1} KW=Complete proteome; Reference proteome OX=373994 OS=Rivularia sp. PCC 7116. GN=Riv7116_3040 OC=Bacteria; Cyanobacteria; Nostocales; Rivulariaceae; Rivularia.
Sequence length 276
Sequence
MVIKILLIIAALFAFSSIAFYIKFLSERQEVNTIWHLLETKTSNNTFTTEMIAELPQPVQ
RYFLHAIEQGTPLANSVKLNMNGSFRLSADKPWLPMQAEQIIRAFKGFVWKAKIGSGLMK
FIGSDYCFYNFARMRFSIWGIIPVINAHNQDITRSAIGRLAGESFWLPSALLPQNGVVWQ
AIDNNTIEASMKVDGESVNLTFTIDSDGKLLKVSVLRWGDKTEDGSHTYITFGGEVLEEK
TFAGFTIPSQITAGWWFGTDKYFNFFRANIEKAEFC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]