dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9S5E6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9S5E6|K9S5E6_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFY64989.1} KW=Complete proteome; Reference proteome OX=1173025 OS=Geitlerinema sp. PCC 7407. GN=GEI7407_0489 OC=Coleofasciculaceae; Geitlerinema.
Sequence length 348
Sequence
MTQSVSHSLPLPPHFEAGRVGQVWRVPYQARAEQARAWAKQHAIAPAAKDKTRLCLMAID
VQNTFCIPDFELFVGGRSGQGAVQDNVRLCEFIYRNLGLITEIAPTMDTHTVMQIFHSQF
WVNDAGDNPPPMTTISLAQVQQGHWKVNPAIAHSLAKGNYLLLQSYALHYVQTLSQDGKY
PLTIWPYHSMLGGIGHALVSAVEEACFFHNIARHSQTNFEIKGGNPLTENYSVLRPEVLD
GPDGRPIAQKNTRFIQKLLEFDAVIIAGQAKSHCVAWTIADLLSEIQAQDPALAKKVYLL
EDCTSAVVVPGVVDFTDQADAAFQRFADAGMHLVRSTEAIAHWPDLSL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]