dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9SFJ9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9SFJ9|K9SFJ9_9CYAN) 30S ribosomal protein S3 {ECO:0000256|HAMAP-Rule:MF_01309} KW=Complete proteome; Reference proteome OX=82654 OS=Pseudanabaena sp. PCC 7367. GN=Pse7367_1085 OC=Pseudanabaena.
Sequence length 251
Sequence
MGQKVHPNGLRVGVIRPHLSRWFADGDRYPILASEDFEIRKYITKTLDNAGVADVRIERK
ADQVDIEIRTARPGVVVGRGGSGIDQLRQGLLKHLGKVGTKEKTGTSQIRINVVEVARVD
AEAALIGEYIAQQIERRVSFRRVVRQAIQRAQRAGVEGIKVQVGGRLNGAEIARTEWVRE
GRVPLHTIRADIDYAYRTASTVYGIIGVKVWIFKGEIEPGQEAAAPAQPQPRRRQQQRRR
PQFEDRSGAEG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]