dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9SVJ5 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9SVJ5|K9SVJ5_9SYNE) Serine phosphatase RsbU, regulator of sigma subunit {ECO:0000313|EMBL:AFY73774.1} KW=Complete proteome; Reference proteome OX=1173263 OS=Synechococcus sp. PCC 7502. GN=Syn7502_01722 OC=Synechococcus.
Sequence length 440
Sequence
MKAPIPDNEQARLAALYQYQILDTVAEVLFDDFTHLASQICGMPIALISLIDHDRQWFKS
KLGLESSETPRDQAFCAHAILNPDQPLIVEDATADVRFADNPLVTGDTNIRFYGGFPLVT
PDDFAIGTLCVIDQKPRTLMPEQEAALKMLSRQVISQLELRLKLQEIEERTKDLEQANGI
INCLNEKLAAENIRMGAELSVAQKIQMMILPKVGELELIPELDVAAYMEPAAEVGGDYYD
VIYHDGRVKIAIGDVTGHGLSSGIIMLMAQTAVRTLIGAGETNPVKFLGAVNQTLYDNAH
RMDSCKNMTLTILEYANQTLRVSGQHEEIIIVRRDGSLERLDTMDLGFPLGLELDIDAFI
GEAVIDLQPDDLVLLYTDGIPEATNSENQFYGLERMCAIAQKYHHLSATDVCKAVIKDVM
HFIGQQKIYDDITLIILKQR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]