dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9VTP0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9VTP0|K9VTP0_9CYAN) Tetratricopeptide TPR_1 repeat-containing protein {ECO:0000313|EMBL:AFZ11448.1} KW=Complete proteome; Reference proteome OX=1173022 OS=Crinalium epipsammum PCC 9333. GN=Cri9333_0484 OC=Gomontiellaceae; Crinalium.
Sequence length 1192
Sequence
MNNRTLTLISCLLLLSTPVITASAIYAQQPNLTAPDDVPPPIPLQEKEKIAAEITVKISS
GNNGGSGVLIAKKQQTYLVLTNAHVVDNSKNLQISTPDGKIYTAQLVPNSKLGNYDLALL
QFTSNKEYSIAQYDPSNLPRMNGDILAVGFSGESGKLVYRPGKITYLPERSLKQGYGLGY
NSNVVQGMSGGAILNEYGELIGINGRSSYPILNSGYVYEDNAKPTPAEVQKLRGSSWGIS
LQTFLAQLPQDFARAYSFPQPPISIPDVNNEPELTGWLGQLNEQARKFTVRINNKNDDRD
SGSGVIIAKQNNTYYVLTCAHVIKNSTNYEIVTPDGKIYSVDYSRVRKEEGVDLAVVQFN
SNDSYQVATIGNVAAKDEQYTFVTGYSKFGNKQSQWRFSPGDISEQEVGLLRVKNYRVEG
RNQSAVAAESAISLTGGYELVYRNITYGGMSGGAVLDSLGRVIGIHGSAEGEIAIDDSSS
DLNKLQFGYSLGIPAKTFLGIANRLQVNSGLLKVENSPPPDLNAVQQDAVKKTILTVGVP
QGNAKASVWLQRGNQLWRLRRYDEAIAAFDAAIKLQPAFVHLAWYGRGLVLYAQKKYSEA
SVAISTAISKKPDYYPALKLQSQVLTQLKQLDEALVAIEKAIVIQPQDPNLYFIKTSILS
DLKRYPEAIATIQKGIDISPRAALYWIRGNVYVNQKQWDKAINDYNTAIKINPQYANAYL
MRGGVYSDQKQWDKAIDDYNTAIKINPQYANAYLMRGDVYSDQKQWDKAIDDYNTAIKIN
SNNAWAYSARGLVYYKQKQWNKAIDDYNTAIKINPGDAFAYSARGLVYKEQKQWDKAIDD
YTTAIKINPQYADAYSLRGRVHDQQKQWDKAIDDFTTAIKINPNNANDYSLRGLVYVNQK
QWDKAIDDFTTAIKINPHDAGAYSVRGLVYQEQKQWDKAIDDFKSAIKINPGDASAYLSR
GEVYSYQKQWDKAIDDFKSAIKINPNDALAYYNRGNVYVNQKQWDLAINDYNSAIKINPQ
YAEAYYNRGIVYSNQKKWELALADWNQAIKINPKFAEAYFNRGFVYHTQENYSAALSDYK
QALSINENLIAAISNIGFINYEMGETEAAIQQWQKVVKVDSQQAEPQLALAVAMYTKGES
DKGVQLAAQALKLDKQFADVAYLKQNLWGKRIIADTQKLFADAKMKAVLAGL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]