dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9W8N6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9W8N6|K9W8N6_9CYAN) Beta-glucanase/beta-glucan synthetase {ECO:0000313|EMBL:AFZ16166.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_0233 OC=Microcoleaceae; Microcoleus.
Sequence length 284
Sequence
MPFILSNKIRYLGLLLVLSLLMVLIINTPLIAQSKPSSIQPNWTLIWSDEFNGTSVDTTK
WNIIDRIGDINNELHYNTPDAVSVSDGYLVIKSDKVDLGGRAYISGKINTRGKFDFTYGR
VEICSQQAATQGLLSAEWLLHYQDTGDSASQYWPPEFDVVEVLGKDSSTAYQSVHYGICY
HCRWPSKASSTTKINGSNFTSKFHIFALEWEPTEIRWYIDGRLTKAWTTPITTDDPPIID
EPMQIILGTAVGGNWPGSPDTTTVFPAYHYVDYVRVYQRTARSR

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]