dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9WIQ3 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9WIQ3|K9WIQ3_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:AFZ19417.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_3697 OC=Microcoleaceae; Microcoleus.
Sequence length 633
Sequence
MPDSRPLRDQYIELIDEIVQATLKGKIRSKEQVYQMLLQGVSTGTGEIFDRCLDEQMNAT
QQQVDNPVSEMKQAKAIRSLRALKTLSGEWERVQEKKRTSQALTGAVQAITTVDSSERLT
ALLRVIDPNRQQVLNLQQLAQLGKDLQQQAQQSSDPDTAQELQQLSQGITAGLTSWQRLE
DYVVSWIYDQNQGLGFEGLPEQRGPWAVWAKQVNSPLPKSLFQAIAQNQSLHEWVDQQPS
LELSSWVELAVILQCLQRGLVAWFDKMVYDSKMGAKLSISTFIVFAVIWSQLANALSQAI
TLAEREVLINGCFQVSLQILRAFAQRDYFPLYGGVFASLNGNSLRDALNYLDEPLRQVEG
TQEKARILTLLGYSLRAQGLYDRATAFHQQALEIARGAGDRICEIANLNHLSRICVAQKN
YAEAINYSQRALILSRQSGDRLGEANALTNLGYSEVFQAKEQAQLESEVYETAIHYLEQS
LQLLARLGDSLGGGYASQQSQSLCFSSLGIAHVVIEQPQKAITYLEQGWQAAQISGDLYL
QGVNLAYLAQACYSLQNLAQTLYTGSLGAYLLEQIGSSDWRQPAGLLTILQGQLGAEVFQ
TLLEQERSKIIAFIGVDGYDYIPQLLQKYRDSM

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]