dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9WMG6 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9WMG6|K9WMG6_9CYAN) Histidine kinase,histidine kinase,GAF domain-containing protein {ECO:0000313|EMBL:AFZ20732.1} KW=Complete proteome; Reference proteome OX=1173027 OS=Microcoleus sp. PCC 7113. GN=Mic7113_5075 OC=Microcoleaceae; Microcoleus.
Sequence length 1182
Sequence
MSQPELSQEDLLRRITNRIRQSLELEEILTATVAELRSLLGTDRVIVYQFHASGSGEVMA
ESIQDNCLPSLKGLNFPADDIPETARQKYMEKRLCSFVDVGLGRIGWLPIDCCITSEETI
PLEELVEYHPVDSCHAAYLTAMGVQSTVVLPIVHNNIQSEHAKEQLWGLLVCHSIQLRVI
SRRELQVMQWAIDQVSIAIAQSHLLAKTRQQHFVEATTNRVATLLHSLPTIELSAALEET
VTALQGCGGRLYIAPYTTDDRAEVLTCGTQLAPLIGETESLIEQHPVFTAWTSCLEENTL
FLRERREPEENSSSQPGNPPIDSSPTPTPKGVPFFPSCSPLTVTNLYSLPDWRTLTPAFQ
FTTIRGILVMPLYYRSSFLGYLSIFRPEIDTETLWAGRFDPSEKQRLPRQSFEVWRELKR
GQAKEWTRQDIELAVALGHQFAMAIEQYELYSLVQSLNANLERQVEERTAKLQQALEQGR
ALERVTSQIRSTLDLNTILQTIVREVRSLLDTDRVVIYQFADNAQGKVIVESINGDWFST
LGASDPHGYFLETQSQPYKRGRVRVISDVARAPLAPAQREFLQRFHIQATLIVPIGMGAY
HSQDIFSCGCTPTSLHKNQEEQPLWGFLIAQECHAPRSWQAFEIDLLQQLADQAAVAIQQ
AELYDKSRTAAATATAQAKQLAIVAQQQQALFGVITKIRESLDVKAIFKATTTEVRRLLA
ADRVAVFRFAPEFGYDHGEVVSEDIQPGLPEANRNIQDYCFGEKYRSGWIQAIPDIYNAG
LNDCHIKILEQLHVRSTLMVPLPKGDTLWGLLCIYQCTGLRYWDTSEIDFVRQVAVHLGI
ALQQAGLLEDKEQQAAEIAFTLENLKQAQTQLIQTEKMSSLGQLVAGVAHEINNPVNFIY
GNLTYTNQYAHDLLNLLHLYQKYYPEPDLEVDEYAKAIDLDFLKEDLPKILASMKIGSER
IRNLVLSLRNFSRLDQAEMKPVDIHEGIDSTLLILQHRLKGKPNYPGITVVKTYSELPLV
ECYASQLNQVFMNVLSNAIDALEDYHISRTAEGMKVHQSQITISTRVKPVDLERIGDRNG
ENSPSSLPTSPHVVIEIADNGPGISPALLSKVFNPFFTTKPIGKGTGLGLSISYQIVVEK
HGGSFRCDSQIGQGTQFRIEIPIQQPKPTPERPLLASEPVRG

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]