dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

K9YC52 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|K9YC52|K9YC52_HALP7) Uncharacterized protein {ECO:0000313|EMBL:AFZ44047.1} KW=Complete proteome; Reference proteome OX=65093 OS=Halothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)). GN=PCC7418_1879 OC=Aphanothecaceae; Halothece cluster; Halothece.
Sequence length 627
Sequence
MTNKLIYRSLGLVLISLLSGCASETLYSSPFNSEDDQLLETSQLLDHSPTLPQEKQFPND
IGWINIKQDYGAKGDGKTDDTQAIQKALATPYSSYNRPKLIYFPKGTYLVSDTLQFPAEG
MQCCVTFQGQGRDNTIIKLKDNLPAYRADAAAAVIRTRAGNIAFRNYIRDLTVNTGRGNP
GAVGIDYISNNRGAIKDVTIKSEDGQGRIGLSMLRQWPGPSLIKNVSIEGFDVGIRTFHS
VYGMVFENINLSNQNEVGLQNTSNTIAIRNLKSNNSVPVIHNVGNGLTILLNGEFQGGSS
SVSAINNRAYIYARNVTAQGYQSAIQNWDHIVPDLYHREYIFDRVDSLFDAPKHSLQLPI
EETPVFHDNNLNHWANVKDYPSVQAAMNSGHSTIYFPRGDYPTSGFINIPDTVKKIIGFE
SRLGAPKNEKVVFQITDKSTDPLIIEGFILNERVTIQHASPRTLALKYSQLQGSLLNSKE
AGKLFLEDVQTELHLDYPQQVWARQLNIETLSNPRTKISNNGGNLWILGLKTEGKGSVIE
TTNGGQTELLGTVIYPVRKFTDAEQKTQAAFVNENSNHSLIYSLSAASAQRNYQIQVKEI
RNGETKVFLTEDLPSYQIPLFVGYNNN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]