dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

L5LZB2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|L5LZB2|L5LZB2_MYODS) Low-density lipoprotein receptor-related protein 3 {ECO:0000313|EMBL:ELK31365.1} KW=Complete proteome; Reference proteome OX=225400 OS=Myotis davidii (David's myotis). GN=MDA_GLEAN10022575 OC=Vespertilionidae; Myotis.
Sequence length 767
Sequence
MDVPADVPGLDQLLVGLMALVFTLDSSGEASTSPPLLTAACSGKLEQHTERRGVIYSPAW
PLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEAFRLCGS
AIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLPGP
WQCNTVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGTQDCGD
GSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDTRRVLLQLELRL
GYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATY
QVKGYCLPWEQPCGSSIEGDMGDTGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYP
CEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQD
GSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEA
EFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRR
RLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQPAPGAALDPPAPLTDTGSAGA
AGDGSPSAPVHTPEVGPSVLPPLSLQDPEYRPVDKDRKACRDPLMDSPASVDMPREPCSA
QDPHSLAPTAGSTLGPHPPEPLGVCRSPPPPCSPTLEASDDEALLVC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]