dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

L8ILS4 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|L8ILS4|L8ILS4_9CETA) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} OX=72004 OS=Bos mutus (wild yak). GN=M91_13007 OC=Pecora; Bovidae; Bovinae; Bos.
Sequence length 1234
Sequence
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDSNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNKQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRLGSGVPDS
SVRKRPLEQSNSALSESSATTEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPRKSLGE
EGLQRGPDVLGPAYREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVPMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANAVRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQSGPETSQETQTQQL
GCQLNPHPTPSPLDASPRRPPGPATSPTSSSISSSISSPGQRDDLIASILSEVAPAPLDE
LRGHKALVKLRSRQERDFRELYKKHQRKAVALTRRLLDNLAQARAGSRCRQRPGVLSGED
ERAEEEEVSRYQEFQKKQVQCLLELREAQVDTEADRRLEHLQQAQLKLREVVLDAHMTQL
KKLKEINEREKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRQERLVAGQQQILQQLAEEEPKLLAQLVQDCQEQRERLPQEIRWSLLGETQEGLG
DGHLVACASNGHAPGSSGHLPGADSESQEETTKL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]