dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M0XS13 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M0XS13|M0XS13_HORVV) Uncharacterized protein {ECO:0000313|EnsemblPlants:HORVU7Hr1G092730.5} KW=Complete proteome; Reference proteome OX=112509 OS=Hordeum vulgare subsp. vulgare (Domesticated barley). GN= OC=Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
Sequence length 268
Sequence
MSKTRPRFIKLLRPDDWEKMTIPDEFVQQHLIGAESCPSSQKALIIGPTGKLWPVELDQR
QSDVLYGEVWAEFLTAHDLSEGSILLFRYEVNMSFSVQVFLPNGCMKEYPYLADEADGSS
PLLPQSDKQLVAPSVSKRSYNKRQVVSGIPATFPAMKAQKVQSQSKPAGVVGRHSFTKQI
TSYSLKSLFAVKLTFCSSIGLLEACTIQLKTSMGGSARSWPVAFNIANTYGFLTGKGWKR
FCQDNEVEEGDRCTFKVVEKMVWHVVIN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]