dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M3XRZ9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M3XRZ9|M3XRZ9_MUSPF) SH3 and multiple ankyrin repeat domains 3 {ECO:0000313|Ensembl:ENSMPUP00000001849} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SHANK3 OC=Mustelinae; Mustela.
Sequence length 1712
Sequence
LEGPGFTALGVVVRVNHDPAPPQKCLRLDPAAPVWAAKQRVLCALNHSLQDALNYGLFQP
PSRGRAGKFLDEERLLQEYPPNLDTPLPYLEQFRYKRRVYAQNLIDDKQFAKLHTKANLK
KFMDYVQLHSTDRVARLLDKGLDPNFHDPDSGECPLSLAAQLDNATDLLKVLRNGGAHLD
FRTRDGLTAVHCATRQRNAAALTTLLDLGASPDYKDSRGLTPLYHSALGGGDALCCELLL
HDHAQLGTTDENGWQEIHQACRFGHVQHLEHLLFYGADMGAQNASGNTALHICALYNQES
CARVLLFRGANKDVRNYNSQTAFQVAIIAGNFELAEVIKTHKDSDVVPFRETPSYAKRRR
LAGPSGLASPRPLQRSASDINLKGEVQPAASPGPSLRSLPHQLLLQRLQEEKDRDRDGDQ
ENDIGGPTAGRGSQRKIRELFPSGNLPEPGKGGSLPTPPASEQREGGGLRASASVPSRKF
IAVKAHSPQGEGEIPLHRGEAVKVLSIGEGGFWEGTVKGRTGWFPADCVEEVQMRQYDTR
HETREDRTKRLFRHYTVGSYDSLTSHSDYVIDDKVAVLQKRDHEGFGFVLRGAKAETPIE
EFTPTPAFPALQYLESVDVEGVAWRAGLRTGDFLIEVNGVNVVKVGHKQVVALIRQGGNR
LVMKVVSVTRKPEEDGARRRAPPPPKRAPSTTLTLRSKSMTAELEELASIRRRKGEKLDE
ILAAAAEPALRPDIADADSRAATVKQRPTSRRITPAEISSLFERQGLPGPEKLPGSLRKG
IPRTKSVGEDEKLASLLEGRFPRSTSMQDPVREGRGIPPPPQTAPPPPPAPYYFDSGPPP
AFSPPPPPGRAYDTVRSSFKPGLEARLGAGAAGLYDPGAPLGPLPYPERQKRARSMIILQ
DSAPEMGDVPRPPPAATPPERPKRRPRPPGPDSPYANLGAFSASIFAPSKPQRRKSPLVK
QLQVEDAQERAALAVGSPGPTGGSFAREPSPTHRGPRPSGLDYGLADSPGLAFGGPGPSK
DRRLEERRRSTVFLSVGAIEGSPPSADLPSLQPSRSIDERLLGTGPTAGRDLLLPSPVSA
LKPLVSGPSLGPSGSTFIHPLTGKPLDPSSPLALALAARERALASQAPSRSPTPVHSPDA
DRPGPLFVDVQARDSERGALASPAFSPRSPAWVPVPARREPEKAPREERKSPEDKKSMIL
SVLDTSLQRPAGLIVVHATSNGQEPSGLAAEEERPGTPELAPTPTQSAVVAEPLASPRAQ
PPGSAPPSEPGPGQGSSEEEPELVFAVNLPPAQLSSSDEETREELARIGLVPPPEEFANG
VLLATPLPGPGPSPTTVPGPASGKPSSEPPPAPESAADSGVEEADTRSSSDPHLETTSTI
STVSSMSTLSSESGELTDTHTSFADGHTFLLEKPPVPPKPKLKSPLGKGPVTFRDPLLKQ
SSDSELMAQQHHAASAGLASAAGPARPRYLFQRRSKLWGDPVESRGLPGPEDDKPAVISE
LSSRLQQLNKDTRSLGEEPAGGLGGLLDPAKKSPIAAARLFSSLGELSTISAQRSPGGPG
GGASYPVRPGGRYPVARRAPSPVKPASLERVEGLGRPFGLTPPTILKSSSLSIPHEPKEV
RFVVRSVSARSRSPSPSPLPSPAPGPGPXSKFDVGDWLESIHLGEHRDRFEDHEIEGAHL
PALTKDDFVELGVTRVGHRMNIERALRQLDGS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]