dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M3YNF2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M3YNF2|M3YNF2_MUSPF) Phosphoinositide phospholipase C {ECO:0000256|RuleBase:RU361133} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=PLCB3 OC=Mustelinae; Mustela.
Sequence length 1233
Sequence
MAGARPGVHALQLEPPTVVETLRRGSKFIKWDEEASSRNLVTLRVDSNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVAGPDPVNTTFLNF
MAVQDDTAKVWTEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLNFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSADMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIDPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHQPSTGVPNS
SVRKRPLEQSNSALSESSAATTEPSSPQLGSPSSDSCPGLSNGEEVALEKPSLEPRKSLG
EDGLQRGTDALGSADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEP
VKFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNY
MPQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVI
VDGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEE
PFDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYICLRNEANQPLCLPALL
IYTEASDYIPDDHQDYAEALINPIKHVSLMDQRAKQLAALIGESEAQASPETCQETPSQQ
LGSQLTPNPTPSPLDTSPPLRCGAGLCGRGVGRSRGARQPPPSPPVLCCSEVAPASLDEL
RGHKVLVKLRGRQERELRELHKKHQRKAVALTRRLLSGLAQARTEGRCRPRPGVPGGENE
EEEEEEAKQYQEFQKRQVQSLLELREAQADTEAERRLEHLRQAQLRLREIVLEAHTTQIK
RLKEVNEREKKELQKILDRKRHNSISEAKTREKHKKEAELTEINRRHITESVNSIRRLEE
AQKQRHERLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGETPEGLGD
GHLVACASNGHAPGSSGHLSGADSESQEENTKL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]