dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M3YVC9 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M3YVC9|M3YVC9_MUSPF) GATA zinc finger domain containing 2A {ECO:0000313|Ensembl:ENSMPUP00000015289} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=GATAD2A OC=Mustelinae; Mustela.
Sequence length 639
Sequence
MHRSHFRMTEEACRTRSQKRALERDPAEDDVESKKIKMERGLLSSDLNTDGDLRVTPEPG
AGPAQGLLRGAEVPTVGRCEGQAGDGPVDMRTSYSDMKSERRAPSPDVIVLSDNEQPASP
RVNGLTKEALKETSTEALMKSSPEERERMIKQLKEELRLEEAKLVLLKKLRQSQIQKETT
TQKPTGSAGSAVTTPPPLVRGTQNIPSGKPSLQTSSTRMPGSVIPPPLVRGGQQVSSKLG
PQASSQVVMPPLVRGAQQIHNIRQHSSTGPPPLLLAPRASVPSVQIQGQRIIQQGLIRVA
NVPNTSLLVNIPQPSPASLKGTTATSAQANSTPTSVASVVTSADSPASRQAAAKLALRKQ
LEKTLLEIPPPKPPAPEMNFLPSAANNEFIYLVGLEEVVQNLLETQAGRMSAAAVLSREP
YMCAQCKTDFTCRWREEKGGAIMCENCMASNQKKALKVEHTSRLKAAFVKALQQEQEIEQ
RLLQQGAAPTQAKAEPAAAPHPALKQVIKPRRKLAFRSGEARDWSNGAVLQASSQLSRGS
TTTPRGVLHTFSQSPKLQNAASATALVSRTGRHSERAVSTGKGNATTNWKKAPLSTGGAL
AFVSPSLAVHKTSSAVDRQREYLLDMIPPRSIPQSATWK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

No Significant Domain Assignments. Without architecture containing the known domains, dcGO Predictor can not do anything. 1

Jump to [ Top · Protein sequence · Domain architecture ]