dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M3Z1T8 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M3Z1T8|M3Z1T8_MUSPF) Potassium two pore domain channel subfamily K member 15 {ECO:0000313|Ensembl:ENSMPUP00000017550} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=KCNK15 OC=Mustelinae; Mustela.
Sequence length 337
Sequence
MRKQSVRTAALILCILSYLLVGAAVFDALESEAERGRQRLLAQKRGEFRRKYGFSAEDYR
ELERLALQAEPHRAGRQWKFAGSFYFAITVITTIGYGHAAPGTDLGKVFCMFYALLGIPL
TLVTFQSLGERLNALVRRLLLAAKRCLGLPRPRVSTENMVVAGLLVCATTLALGAAAFAH
FEGWTFFHAYYYCFITLTTIGFGDFVALQSDEALQRKPPYVAFSFLYILLGLTVIGAFLN
LVVLRFLAASTDAPXXXXXXXXXXXXXXXXXXXXXXXXRGRSPPRRPIRARGSTSVSSRV
YQLQMGARDNLGFSPPSSPGAVGSGGAGRLPARRKSI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]