dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M3Z3G7 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M3Z3G7|M3Z3G7_MUSPF) Solute carrier family 26 member 3 {ECO:0000256|RuleBase:RU362052} KW=Complete proteome; Reference proteome OX=9669 OS=Mustela putorius furo (European domestic ferret) (Mustela furo). GN=SLC26A3 OC=Mustelinae; Mustela.
Sequence length 760
Sequence
MIEPIGNQYVVARPVYSANNLSISEHSEMRAEESSQLKCCKSQANCSTQKAKKIALSLFP
IASWLPTYQIKEWLLSDIVSGISTGLVAVLQGLAFALLVTVPPSYGLYAAFFPVLVYFFL
GTSKHISVGPFPVLSMMVGAVVVKLTPSESTAALEISNSSMSNDSSTDEYKVMVAATVTV
LSGIIQLLMGVLRVGFLVIYLSESLISGFTTAAAVHVLVSQLKFMLQLTVPAHTDPFSIF
KVLNSVFTQIEKTNIADLVTSLIILVIVFVVKEINQRYKAKLPVPIPIELIMTVIATGVS
YGFDFENRFKVAVVGEMKRGFQPPIAPDTQIFQETIGDSFGIAIVGFVVAFSVASVYSLK
YDYPIDGNQELIALGLSNIFSGSFQGFAGSTALSRSGVQESTGGKTQIAGILSAIIVLIV
ILALGFLLEPLQKSVLAALALGNLKGMLMQFTEIRRLWRKDKYDCLIWIMTFIFAIVLGL
GLGLAASVAFQLLTIVFRTQFPKCSTLANVGRSNIYKNKKDYSDMYEPEGVKIFRCPAPI
YFANIHFFKQKLIDAVGFNPLRILRKRNKALKKIRKLQKKGLLQVTPKGFICTNDGFKDS
DDELDNNEIEELDQPIHTSDLPFQIDWNADLPLNMVVPQISLHSLILDFSAVSFLDISSM
RGLKTILQEFIRINVDVYIVGSDDDFIEKLVQCEFFDDEVKDSIFFLTIHDAVLHIWMTK
DYNASKFNASQEKEMKFDFTINTNGGLRNRECQVPVETKF

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]