dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

M9WGK2 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|M9WGK2|M9WGK2_9MOLU) Ribonucleoside-diphosphate reductase {ECO:0000256|RuleBase:RU003410} KW=Complete proteome; Reference proteome OX=1292033 OS=Mycoplasma putrefaciens Mput9231. GN=MPUT9231_0580 OC=Bacteria; Tenericutes; Mollicutes; Mycoplasmataceae; Mycoplasma.
Sequence length 719
Sequence
MKDSKELILDDSNDEYIKLNARSKIFAKGQDNFKLDVQAAKSYITNHIEPRLMQFDDLKQ
RIDYLVANEYYDKQILDKYQFEEITELDDYAKSFNHSFPSFMGALKFFNAYALKTFDGEK
YLETYTDRALMNALFLGNGSYQKAKNILKNIMLGRFQPATPTFLNAGKKHRGEYVSCYLL
RTEDNMESICRTISTSLQLSKRGGGVAVCLTNLRETGSPIKNIDGLSSGPIPVMKILEDS
FTYADQLGQRQGAGAVYISAHHPDIISFLDTKRENADEKIRIKSLSLGVVIPDITFELAR
ENKEMALFSPYDVQKVYGVALSDISITEKYYEMLENPNIKKTFISARKLFLTIAELHFES
GYPYLLFEDTVNRRNAHDKKGRIIMSNLCSEIVQVSTPSQYNQDLSFTKIGEDICCNLGS
LNIDKMMKAGKEFEEAVDISITALDVVSRNSDLDCAPSIKFGNANNHAVGLGAMNLHGFL
ATNAIMYDSPEAVDFTNIFFYTLAYNAFKASNRLAKEFGKFNSFDESRFADGSWFEKYTK
CQADKWTPATKKVEELFKHYQVEIPTQTQWIELVEEIKKTGLANSHLMAVAPTGSISYLS
SCTPSLQPVVSTVEVRKEGKLGRVYVPAYQINFDNMGYYAVGAYEMGPDPIINIAAAAQQ
HVDQAISLTLFMTDKATTRDLNRAYINAFKQGCASIYYVRIRQDVLEDSENYECDACKI

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]