dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

O24172 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|O24172|ALL6_OLEEU) Major pollen allergen Ole e 6 OX=4146 OS=Olea europaea (Common olive). GN=OLE6; OC=Pentapetalae; asterids; lamiids; Lamiales; Oleaceae; Oleeae; Olea.
Sequence length 50
Sequence
DEAQFKECYDTCHKECSDKGNGFTFCEMKCDTDCSVKDVKEKLENYKPKN

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]