dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

O88204 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|O88204|LRP3_RAT) 105 kDa low-density lipoprotein receptor-related protein KW=Complete proteome; Reference proteome OX=10116 OS=Rattus norvegicus (Rat). GN=Lrp3; OC=Muroidea; Muridae; Murinae; Rattus.
Sequence length 770
Sequence
MEKRAAAGPEGAPGARAPLAVVCLVNLFLTGRLSSAVPALAACSGKLEQHTERRGVIYSP
AWPLNYPPGTNCSWYIQGDRGDMITISFRNFDVEESHQCSLDWLLLGPAAPPRQEAFRLC
GSAIPPAFISARDHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQTDEFRCDNGKCLP
GPWQCNMVDECGDGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPVERRCDGTQDC
GDGSDEAGCPDLACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLEL
RLGYDDYVQVYEGLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNA
TYQVKGYCLPWEQPCGSSSEGDDGSTGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQ
YPCEGGSGLCYAPADRCNNQKSCPDGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDC
QDGSDEHGCLAAVPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRL
EAEFVRREAPPSYGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPS
RRRLGRLWNRLFHRPRAPRGQIPLLTAARTSQTVLGDGLLQAAPGPVPDPPVPNTDTGSP
REAGDGPPSGSGHAPEVGPSVPPPPLNLRDPEYRPEDKERKACVDPLEDSPAPVDTPPEP
CLAQDPHPQTPTASGIQDPHSAEPLGVCRSPPPTCSPILEASDDEALLVC

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]