dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

P50534 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (sp|P50534|MSL2_DROME) Protein male-specific lethal-2 KW=Complete proteome; Reference proteome OX=7227 OS=Drosophila melanogaster (Fruit fly). GN=msl-2; OC=Ephydroidea; Drosophilidae; Drosophila; Sophophora.
Sequence length 773
Sequence
MAQTAYLKVTRIAMRSASNLSKRRVEELNSGLGELRQLLSCVVCCQLLVDPYSPKGKRCQ
HNVCRLCLRGKKHLFPSCTQCEGCSDFKTYEENRMMAAQLLCYKTLCVHLLHSALFGELA
GMRPQVARELVPRIKLPPKTTQEFIREGSNISDTFDIFLPQPDLPFLKDMPTSLPAETPP
TSAVTTPELPYDHHLNISDIEAEAAATAEQGHFSPLPLLPTGSRMGMLSHAGQIVIATES
SESGFMDQAWTDQVDLSGTVSVSKYTNSGNNFAVSYVMPTSATTKFDPQELQIGQVVQMA
DSTQLAVLAAVEETVETSTQLTVLSTTVEETVETSTQLEVLTSAEEPNEISDQLANLQVE
ESDEALVEETVEEAEGTSIPSEVVAEHMEEDQHLDVHTSQSPTQTEMEEAVEEHVATKTQ
LGHVQTELQDAESLQKDFEDAKAAAEEAKEKEKDLHAISAELQKEDSDEPTLKRKRTRTL
KASQAAKIEPVPSEVKTKVQSGKGALRRIRGKDKEEKVKPPKPKCRCGISGSSNTLTTCR
NSRCPCYKSYNSCAGCHCVCCKNPHKEDYVESDEDDDLEDFEMPKDVPEPMTQSEEPVVA
EPRQEENSMAPPDSSAPISLVPLNNLQQSQHPLVLVQNEKGEYQGFNIFQGSKPLDPVTV
GFTIRVQLQHTDGFGSLPQYAYIMPTIDPPNPPAPSLSPPPPPAPDREVIEPPAKKFRTS
RTRRGRANFSALDTVDELVSGGSRSNSAAGDRSSATDNAHSLFEEIMSGSDDL

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]