dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q0GU33 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q0GU33|Q0GU33_9LACT) ORF10 {ECO:0000313|EMBL:ABG00292.1} OX=1358 OS=Lactococcus lactis. GN= OC=Lactococcus.
Sequence length 846
Sequence
MNKNRGSQFRKWVLHLHSLYSHSQLSNQYNINENNHEERFDEFLKKLNENDIKAIGLTNY
FNFSEQDYCLKRKLEEKGIVVFLNLELRLENGNVKDETCDIHIIFDNLLDEKEVKCFLAS
MTAKVVNKRLDSISSKDDYKKAVVNFDDLVKCLNDKSLNLKNRYMIGILSRGKGSSRLSS
VFEDIAERCDFFIHSSDKQKNIEEDKEYLNSHGKPLLQSSDAHSFEKIGGKFSWIKADLN
FEGLRQIMFEPSERISLGKDNPDTKLDYQVIDSIELSDARIIYLNSSLNTVIGGRSTGKS
TLTNAIAKALGNEHFVPINEKTEKGMHVFDKDIIIHWRDGQEHQDLEFLPQDYMIKIAEN
DILRNNLVRSTVKSDEGNYRKIEKYEEDTRKNQNEIDNSIQEWSNLKDKLATLIKPEGDK
KGIEVQLQKLKEQISEQEKKSDFSERKSEEYRKSETELNYYLNHQRLSEINIRNLNDMGS
IEISLSTPIPSSDDTKFRESLEEYIEVLKTEVNEKWQQKIKELTDEQNEIFSENKLKVNE
IWNSEIFKQGQTNISNNETLRKLIEIQKQEQLKLDTFIKYENNKEKIETQINEIQTKILR
SYAKFGTLREKLQNEFEVKATPVEIKINFQPIKFEEKIKYLNGRNTTNNNFIEEFDKDSF
RKIDNIFDALNLSYNQGKSQNDLIKDVLSQHWYTINYNLQYDGDNFEQMSQGKKAFVVLT
LILEFSKDKKPVIIDQPEDSLDNRAIYNDLTNYLKEKKKERQIILVTHNPNIVVGADAEN
VIVANQHSEDSPNTHGIQFDYTNGSLENTYTKSMKYTLEKQGIREHVVEILEGGKEAFEK
REKKYK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]