dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q0ICP1 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q0ICP1|Q0ICP1_SYNS3) DNA-(apurinic or apyrimidinic site) lyase MutM {ECO:0000256|HAMAP-Rule:MF_00103} KW=Complete proteome; Reference proteome OX=64471 OS=Synechococcus sp. (strain CC9311). GN=sync_0561 OC=Synechococcus.
Sequence length 290
Sequence
MPELPEVETVRRGLANRLDQFVISDLEVCRDRAIASPGGPECFESGLLNCRVGNWMRRGK
YLYSELYRPGSAEANSAEESAGYWGVHLRMTGQFQWIEDDTPPCKHTRVRFWNAKGQELR
FVDLRSFAEMWWVPPDTAVESIITGLKKLGPEPFSQDFKTQYLQERFKGSTRSIKAALLD
QSIVAGTGNIYADESLFAAGICPQTPAGQLNRKQLEKLRECLIEILELSIGAGGTTFSDF
RDLEGVNGNYGGQAAVYRRTGQPCPKCGKAIERIKLAGRSTHWCSSCQTS

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]