dcGO - A comprehensive domain-centric ontology resource for post-genomic research on functions, phenotypes, diseases and more   
  
  

Q0PRN0 (Uniprot 2018_03 genome)

(
show help)
Now Using Gene Ontology (GO). You can switch to another ontology:

Protein sequence

Comment (tr|Q0PRN0|Q0PRN0_CLOCE) Glycoside hydrolase family 26 {ECO:0000313|EMBL:ACL75130.1} KW=Complete proteome; Reference proteome OX=394503 OS=H10). GN=Ccel_0752 OC=Ruminiclostridium.
Sequence length 577
Sequence
MDKNNFLKVFLVLALAALIPLIPAANVPANAMLEEGIKYEFENGVQKNAEIHTDYVGKTD
DGLTFDLSGATCSFIGQKGTSTSVNVDIDQTGLYELVVRYAQPYDKTKKVQYLNVNDSNQ
GEVSFPYTLSWREMSAGIVKLNKGTNNIEFEGYWGYTFFDYLIVKPADESITSLKVEKKL
VNPDATKEAKALMSYLVDMYGKHIISGQQELCGSHNYEESEAEFTYIKDKTGKMPALRGF
DFMNYRGNGLSWDDLCAERVIDWYKNKGGIPTVCWHWFSPANIGKKADNSFYTESTTFSI
SKALTPGTAENTALLNDIKTMSEKFKQLQDAGVPVLFRPLHEAEGGWFWWGAEGPENCVK
LYRLLFDKFTNEYNLNNIIWVWTSYTYDTSSKWYPGDDVVDILGYDKYNAKDGLPNGSAI
SSTFYNMVKLTNGKKLVTMSENDTIPQVSNLTNEMAGWLYFCPWYGWHLTGEQNNPVDWL
KQMYTSDYCITLDELPDLETYPFPSDGDIPTIMYGDLNEDKLIDAIDLALLKKCILENNQ
SLKSADVDGNGSVDAIDFVYMKKFLTGEISGFPASGK

Jump to [ Top · Protein sequence · Domain architecture ]

Domain architecture

1

Jump to [ Top · Protein sequence · Domain architecture ]